PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00340.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 342aa    MW: 37189.9 Da    PI: 8.4959
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00340.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.7e-3951111262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              k++a++cprC+stntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  Rsa1.0_00340.1_g00001.1  51 KDQAINCPRCNSTNTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 111
                              7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2743103IPR003851Zinc finger, Dof-type
PfamPF027014.5E-3352109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.53755109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPLDQIVT NTCPNPQPSQ PQQPPPAGAA CGAERKARPE KDQAINCPRC  60
NSTNTKFCYY NNYSLTQPRF FCKGCRRYWT EGGSLRNIPV GGGSRKNKRS HSSSISSSDI  120
SNNHSVSTQP AKKKHHSDQH HHHLVSMSQQ GLTGQNPKFL ETTQQDLNLG FPPDRLIRTN  180
FTDLIHNTGN NNKSTNNTVI SSSFSATSAM ATSPLDFIRN NNSNNGNSSF MGFPVHTQDP  240
TSVGFSMQDH YKPCNSSTTL LGFSLDHHRN NDFPGGFLGG AGGDDVNGRP LFPFEDLKLP  300
VSSSSATSNV DINDHQKRVS GGDAAATSGG YWTGMLSGGS WC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137416.10.0PREDICTED: dof zinc finger protein DOF4.6-like
RefseqXP_013738034.10.0PREDICTED: dof zinc finger protein DOF4.6-like isoform X1
RefseqXP_013738035.10.0PREDICTED: dof zinc finger protein DOF4.6-like isoform X2
SwissprotQ8LAP81e-166DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLM4DRV40.0M4DRV4_BRARP; Uncharacterized protein
STRINGBra019247.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-138Dof family protein